AibGenesis™ Mouse Anti-Endoa Antibody (CBMOAB-16257FYA)


Cat: CBMOAB-16257FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-16257FYA Monoclonal Fruit fly (Drosophila melanogaster), Drosophila melanogaster WB, ELISA MO16257FYA 100 µg
Inquiry
MOFY-1222-FY160 Polyclonal Drosophila melanogaster WB, IHC, ICC, IF, ELISA 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Drosophila melanogaster
CloneMO16257FYA
SpecificityThis antibody binds to fruit fly Endoa.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRequired presynaptically at the neuromuscular junction. Implicated in synaptic vesicle endocytosis. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Endoa Antibody is a mouse antibody against Endoa. It can be used for Endoa detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEndophilin-A; SH3 domain-containing GRB2-like protein; endoA; endo
UniProt IDQ8T390
Protein RefseqThe length of the protein is 369 amino acids long.
The sequence is show below: MAFAGLKKQINKANQYMTEKMGGAEGTKLDMDFMEMERKTDVTVELVEELQLKTKEFLQPNPTARAKMAAVKGISKLSGQAKSNTYPQPEGLLAECMLTYGKKLGEDNSVFAQALVEFGEALKQMADVKYSLDDNIKQNFLEPLHHMQTKDLKEVMHHRKKLQGRRLDFDCKRRRQAKDDEIRGAEDKFGESLQLAQVGMFNLLENDTEHVSQLVTFAEALYDFHSQCADVLRGLQETLQEKRSEAESRPRNEFVPKTLLDLNLDGGGGGLNEDGTPSHISSSASPLPSPMRSPAKSMAVTPQRQQQPCCQALYDFEPENPGELAFKENDIITLLNRVDDNWFEGAVNGRTGYFPQSYVQVQVPLPNGN.
For Research Use Only | Not For Clinical Use.
Online Inquiry