AibGenesis™ Mouse Anti-ENTR1 Antibody (MO-AB-12052R)


Cat: MO-AB-12052R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-12052R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO12052R 100 µg
MO-AB-23906W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23906W 100 µg
MO-AB-25654H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25654C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO12052R
SpecificityThis antibody binds to Cattle ENTR1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Endosome; Cytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle ENTR1 Antibody is a mouse antibody against ENTR1. It can be used for ENTR1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSerologically defined colon cancer antigen 3 homolog; SDCCAG3
UniProt IDQ2KJD6
Protein RefseqThe length of the protein is 359 amino acids long.
The sequence is show below: MAGYARRPGVTPLSRARSLVIPDDDKLGDLEAANPFSFKEFLKTKNLSLSKEDTDSRVYSQEATRHSLGLDRTSPASQTVGYGLEYQQPFFEDPTGAGDLLDEDEDEEDGWNGAYLPSAMEQTHSSRVAASTSPCSTYVSFFSNPSELVGPESLPPWTLSDSDSRISPTGSPSADFTAHGESLGDRHLRTLQISYEALKDENSKLRRKLTEIQSFSETQTEMVRTLERKLEAKMIKEESDYHDLESVVQQVEQNL.
For Research Use Only | Not For Clinical Use.
Online Inquiry