Mouse Anti-EPGN Antibody (CBMOAB-41864FYA)


Cat: CBMOAB-41864FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41864FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Rat (Rattus norvegicus) WB, ELISA MO41864FYA 100 µg
MO-AB-03332H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03332C 100 µg
MO-AB-03668W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03668W 100 µg
MO-AB-25660H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25660C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Rat (Rattus norvegicus)
CloneMO41864FYA
SpecificityThis antibody binds to Rhesus EPGN.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the epidermal growth factor family. Members of this family are ligands for the epidermal growth factor receptor and play a role in cell survival, proliferation and migration. This protein has been reported to have high mitogenic activity but low affinity for its receptor. Expression of this transcript and protein have been reported in cancer specimens of the breast, bladder, and prostate. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus EPGN Antibody is a mouse antibody against EPGN. It can be used for EPGN detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEPGN
UniProt IDF7AEA2
Protein RefseqThe length of the protein is 133 amino acids long.
The sequence is show below: MALEVPISVYLLFNAMTALTEEAAVTVTPPITAQQTDNVEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYAVDSYEKYIAIGIGVGLLLSGFLVIFYCYIRKRYEKDKI.
For Research Use Only | Not For Clinical Use.
Online Inquiry