AibGenesis™ Mouse Anti-ERMP1 Antibody (CBMOAB-41980FYA)


Cat: CBMOAB-41980FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-41980FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO41980FYA 100 µg
MO-AB-17044W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17044W 100 µg
MO-AB-55097W Monoclonal Marmoset WB, ELISA MO55097W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO41980FYA
SpecificityThis antibody binds to Rhesus ERMP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ERMP1 Antibody is a mouse antibody against ERMP1. It can be used for ERMP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesERMP1
UniProt IDF6PJ43
Protein RefseqThe length of the protein is 351 amino acids long.
The sequence is show below: MLEVLRVLSTSSEALHHAVIFLFNGAEENVLQASHGFITQHPWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIPSDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKHLATSDMLAAASKYRHGNMVFFDVLGLFVIAYPSRIGSIINYMVVMGVILYLGKKLLQPKHKTGNYKKDFLCGLGITLISWFTSLVTVLIIAVFISLIGQSLSWYNHFYVSVCLYGTATVAKIIFIHTLAKRFYYMNVSDQYLGEVFFDIALFVHCCSLVTLTYQGLCSAFISAVWVAFPLLTKLCVHKDFKQHD.
For Research Use Only | Not For Clinical Use.
Online Inquiry