AibGenesis™ Mouse Anti-ET1 Antibody (MO-AB-00719W)


Cat: MO-AB-00719W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-00719W Monoclonal A. thaliana (Arabidopsis thaliana), Maize (Zea mays) WB, ELISA MO00719W 100 µg
Inquiry
MO-AB-48105W Monoclonal Maize (Zea mays) WB, ELISA MO48105W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Maize (Zea mays)
CloneMO00719W
SpecificityThis antibody binds to A. thaliana ET1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTranscriptional regulator involved in the regulation of cell differentiation in meristems. Binds DNA without sequence preference (PubMed:22226340). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-A. thaliana ET1 Antibody is a mouse antibody against ET1. It can be used for ET1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative transcription factor; ET1
UniProt IDO04047
Protein RefseqThe length of the protein is 349 amino acids long.
The sequence is show below: KQILIGANEKENFREGKDLVGRNRVQGAFQGLYELSHDHGRKDDVLVANLGQPESIRSRLRSYSRSFAHHDLLKQGLSQTILPTTQNKSDNQTEEKKSDSEEEREVSSDAAEKESNSLPSILRLSRSRPQPVSEKHDDIVDESDSASACGVLLEDGTTCTTTPVKXRKRCTEHKGKRLSRVSPGIHIPCEVPTVRECEETENICGVILPDMIRCRSKPVSRRKRCEDHKGMRVNAFFFLLNPTERDKAVNEDKSKPETSTGMNQEGSGLLCEATTKNGLPCTRSAPEGSKRCWQHKDKTLNHGSSENVQSATASQVICGFKLYNGSVCEKSPVKGRKRCEEHKGMRITS.
For Research Use Only | Not For Clinical Use.
Online Inquiry