AibGenesis™ Mouse Anti-ETFRF1 Antibody (MO-AB-12157R)


Cat: MO-AB-12157R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-12157R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Rat (Rattus norvegicus) WB, ELISA MO12157R 100 µg
MO-AB-19278W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19278W 100 µg
MO-AB-25678H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25678C 100 µg
MO-AB-44705W Monoclonal Horse (Equus caballus) WB, ELISA MO44705W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Rat (Rattus norvegicus)
CloneMO12157R
SpecificityThis antibody binds to Cattle ETFRF1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle ETFRF1 Antibody is a mouse antibody against ETFRF1. It can be used for ETFRF1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLYR motif-containing protein 5; LYRM5
UniProt IDQ0VCR0
Protein RefseqThe length of the protein is 88 amino acids long.
The sequence is show below: MANSLRGEVLNLYKNLLYLGRDYPKGADYFKRRLKNVFLKNKDVKDPEKIKELIERGKFVMKELEALYFLRKYRAMKQRYYSDTNKTK.
For Research Use Only | Not For Clinical Use.
Online Inquiry