AibGenesis™ Mouse Anti-EVX1 Antibody (CBMOAB-42057FYA)


Cat: CBMOAB-42057FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42057FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Medaka (Oryzias latipes), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO42057FYA 100 µg
CBMOAB-75481FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO75481FYA 100 µg
MO-AB-00467R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO00467R 100 µg
MO-AB-08035Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08035Y 100 µg
MO-AB-25687H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25687C 100 µg
MO-AB-55149W Monoclonal Marmoset WB, ELISA MO55149W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Medaka (Oryzias latipes), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO42057FYA
SpecificityThis antibody binds to Rhesus EVX1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the even-skipped homeobox family characterized by the presence of a homeodomain closely related to the Drosophila even-skipped (eve) segmentation gene of the pair-rule class. The encoded protein may play an important role as a transcriptional repressor during embryogenesis. (From NCBI)
Product OverviewMouse Anti-Rhesus EVX1 Antibody is a mouse antibody against EVX1. It can be used for EVX1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEVX1
UniProt IDF6YAG1
Protein RefseqThe length of the protein is 408 amino acids long.
The sequence is show below: MESRKDMVVFLDGGQLGTLVGKRVSNLSEAVGSPLPEPPEKMVPRGCLSPRAVPPATRERGGGGPEEEPVDGLAGSAAGPGAEPRVAGAAMLGPGPPAPSVDSLSGQGQPSSSDTESDFYEEIEVSCTPDCATGNAEYQHSKGSGSEALVGSPNGGSETSKSNGGGGGGGSQGTLACSASDQMRRYRTAFTREQIARLEKEFYRENYVSRPRRCELAAALNLPETTIKVWFQNRRMKDKRQRLAMTWPHPADPAFYTYMMSHAAAAGGLPYPFPSHLPLPYYSPVGLGAASAASAAAASPFSGPLRPLDTFRVLSQPYPRPELLCAFRHPPLYPGPAHGLGASAGGPCSCLACHSGPANGLAPRAAAASDFTCASTSRSDSFLTFAPSVLSKASSVALDQREEVPLTR.
For Research Use Only | Not For Clinical Use.
Online Inquiry