AibGenesis™ Mouse Anti-EXPA6 Antibody (CBMOAB-22672FYB)


Cat: CBMOAB-22672FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-22672FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana), Tomato (Lycopersicon esculentum) WB, ELISA MO22672FYB 100 µg
CBMOAB-28803FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO28803FC 100 µg
MO-AB-34471H Monoclonal Tomato (Lycopersicon esculentum) WB, ELISA MO34471C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana), Tomato (Lycopersicon esculentum)
CloneMO22672FYB
SpecificityThis antibody binds to Rice EXPA6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCell wall; Extracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMay cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found. May be required for rapid internodal elongation in deepwater rice during submergence. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rice EXPA6 Antibody is a mouse antibody against EXPA6. It can be used for EXPA6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesExpansin-A6; Alpha-expansin-6; OsEXP6; OsEXPA6; OsaEXPa1.24; EXPA6; EXP6; Os03g0336400 LOC_Os03g21820
UniProt IDQ9M4X7
Protein RefseqThe length of the protein is 259 amino acids long.
The sequence is show below: MAPPLLLLLASLLLVAARRALGLGLGQWQPGHATFYGGGDASGTMGGACGYGNLYSQGYGTSTAALSTALFNRGLSCGSCYELRCAGDHRRSCLPGGATVTVTATNFCPPNYALPSDGGGWCNPPRRHFDLAEPAFLRIARHAAGIVPVSFRRVACARKGGVRFTVNGHAYFNLVLVTNVGGAGDVRSLAVKGSGSGSRVGGRWQPMSRNWGQNWQSNAYLDGKALSFRVTAGDGRSLTCADVAPAGWQFGQTFEGRQF.
For Research Use Only | Not For Clinical Use.
Online Inquiry