AibGenesis™ Mouse Anti-EXPA9 Antibody (CBMOAB-22675FYB)


Cat: CBMOAB-22675FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-22675FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana) WB, ELISA MO22675FYB 100 µg
Inquiry
CBMOAB-28806FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO28806FC 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana)
CloneMO22675FYB
SpecificityThis antibody binds to Rice EXPA9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCell wall; Extracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMay cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found. May be required for rapid internodal elongation in deepwater rice during submergence. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rice EXPA9 Antibody is a mouse antibody against EXPA9. It can be used for EXPA9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesExpansin-A9; Alpha-expansin-9; OsEXP9; OsEXPA9; OsaEXPa1.19; EXPA9; EXP9; Os01g0249100 LOC_Os01g14660
UniProt IDQ4PR53
Protein RefseqThe length of the protein is 254 amino acids long.
The sequence is show below: MEKKLLVVLFLSLCCASRLRGEAAQQWTSATATFYGGSDASGTMGGSCGYGNMYSAGYGTNTTALSSALYGDGASCGACYLVTCDASATRWCKNGTSVTVTATNYCPPNYSESGDAGGWCNPPRRHFDMSQPAWEAIAVYSSGIVPVRYARTPCRRVGGIRFGIAGHDYYELVLVTNVAGSGAVAAAWVKGSGTEWLSMSRNWGENWQSNAYLTGQALSFRVQADDGGVVTAYDVAPANWQFGSTYQSDVNFSY.
For Research Use Only | Not For Clinical Use.
Online Inquiry