AibGenesis™ Mouse Anti-EXTL2 Antibody (CBMOAB-42112FYA)


Cat: CBMOAB-42112FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42112FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO42112FYA 100 µg
CBMOAB-75580FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO75580FYA 100 µg
MO-AB-03415H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03415C 100 µg
MO-AB-12200R Monoclonal Cattle (Bos taurus) WB, ELISA MO12200R 100 µg
MO-AB-22481W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22481W 100 µg
MO-AB-25697H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25697C 100 µg
MO-AB-55193W Monoclonal Marmoset WB, ELISA MO55193W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO42112FYA
SpecificityThis antibody binds to Rhesus EXTL2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus EXTL2 Antibody is a mouse antibody against EXTL2. It can be used for EXTL2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEXTL2
UniProt IDF6S245
Protein RefseqThe length of the protein is 329 amino acids long.
The sequence is show below: RCCHICKLPGRVMGIRVLRFSLVVILVLLLVAGALTALLPSVKEDKMLMLRREIKSQGKSTMDSFTLIMQTYNRTDLLLKLLNHYQAVPNLHKVIVVWNNIGEKAPDELWNSLGPHPIPVIFKQQTANRMRNRLQVFPELETSAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTSSGIYSYGGFEMQAPGSGNGDQYSMVLIGASFFNSKYLEFFQRQPAAVHALIDDTQNCDDIAMNFIIAKHIGKTSGIFVKPVNMDNLEKETNSGYSGMWHRAEHALQRSYCINKLVNIYGSMPLKYSNIMISQFGFPYANYKRKI.
For Research Use Only | Not For Clinical Use.
Online Inquiry