AibGenesis™ Mouse Anti-FAAP20 Antibody (MO-AB-12236R)


Cat: MO-AB-12236R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-12236R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO12236R 100 µg
MO-AB-15552W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15552W 100 µg
MO-AB-25698H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25698C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO12236R
SpecificityThis antibody binds to Cattle FAAP20.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle FAAP20 Antibody is a mouse antibody against FAAP20. It can be used for FAAP20 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFanconi anemia-associated protein of 20 kDa; FAAP20
UniProt IDA5PKK9
Protein RefseqThe length of the protein is 192 amino acids long.
The sequence is show below: MEATRRSRLSLSRRRPPLGVRPRSNTAGSLPDGGECAKLWTELLRTASADLNVDGELPPLPAFPDQEPRRSPERPPPETFTVGTETFFWTPFPAPSPGRGGNSGGSDLVLSAVRGRTGSPQQYAAPELRGTPSAEEQPSEEQPSQRQSSVDGAMTLQSCPMCQVDFAPGLAQLDIDGHLAQCLADSTDDIEW.
For Research Use Only | Not For Clinical Use.
Online Inquiry