AibGenesis™ Mouse Anti-FAM167A Antibody (CBMOAB-42303FYA)


Cat: CBMOAB-42303FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42303FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO42303FYA 100 µg
CBMOAB-75820FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO75820FYA 100 µg
MO-AB-12298R Monoclonal Cattle (Bos taurus) WB, ELISA MO12298R 100 µg
MO-AB-25734H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25734C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO42303FYA
SpecificityThis antibody binds to Rhesus FAM167A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAM167A Antibody is a mouse antibody against FAM167A. It can be used for FAM167A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFAM167A
UniProt IDF7GZN0
Protein RefseqThe length of the protein is 150 amino acids long.
The sequence is show below: MSVPQIHVEEVGAEEGAGAAAPPDDHLRSLKALTEKLRLETRRPSYLEWQARLEEQTWPFPRPAAEPQASLEEGERGGQEPLLPLREAGQHAPPARSASRGTTPLSTGKLEGFQSIDEAIAWLRKELVHHQMSKSGGPELPESLCFNPSE.
For Research Use Only | Not For Clinical Use.
Online Inquiry