AibGenesis™ Mouse Anti-FAM168A Antibody (CBMOAB-42307FYA)


Cat: CBMOAB-42307FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42307FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO42307FYA 100 µg
CBMOAB-75823FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO75823FYA 100 µg
MO-AB-03460H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03460C 100 µg
MO-AB-03690W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03690W 100 µg
MO-AB-21038W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21038W 100 µg
MO-AB-25736H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25736C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO42307FYA
SpecificityThis antibody binds to Rhesus FAM168A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAM168A Antibody is a mouse antibody against FAM168A. It can be used for FAM168A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFAM168A
UniProt IDF7EPI7
Protein RefseqThe length of the protein is 244 amino acids long.
The sequence is show below: MNPVYSPVQPGAPYGNPKNMAYTGYPTAYPAAAPAYNPILYPTNSPSYAPEFQFLHSAYATLLMKQAWPQNSSSCGTEGTFHLPVDTGTENRTYQASSAAFRYTAGTPYKVPPTQSNTAPPPYSPSPNPYQTAMYPIRSAYPQQNLYAQGAYYTQPVYAAQPHVIHHTTVVQPNSIPSAIYPAPVAAPRTNGVAMGMVAGTTMAMSAGTLLTTPQHTAIGAHPVSMPTYRAQGTPAYSYVPPHW.
For Research Use Only | Not For Clinical Use.
Online Inquiry