AibGenesis™ Mouse Anti-FAM170A Antibody (CBMOAB-42314FYA)


Cat: CBMOAB-42314FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42314FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO42314FYA 100 µg
MO-AB-25739H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25739C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO42314FYA
SpecificityThis antibody binds to Rhesus FAM170A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAM170A Antibody is a mouse antibody against FAM170A. It can be used for FAM170A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFAM170A
UniProt IDF6XUT2
Protein RefseqThe length of the protein is 373 amino acids long.
The sequence is show below: EIQLRLFILNLFNEFPESQEGPIYRKKREVDLKHLLETLLADTMKRRQKRKHLENEESQETAEKGGGMSKSQEDALQPGSTRVAKGWSQGVGEVTSTSEYFSCVSSSRKLIHGGIQRLHRDSPQPQSPLAQVQERGETPPCSQHVSLSSHSSYKTCVSSLCVNKEERGMKIYYMQVQMKKGVAVSWETEETSESLEKQPRMEEVTLPEVVRVGTPPSDVSTRNLLSDSEPGGEEKEHEERTESDSLPGSPTVEETPRAKTPDWLVTMENGFRCMACCRVFATVEILQEHVQYGIREGFSCHVFHLTMAQLTGNMESGSTQDEQEEENGNEEEEEEKPAAKKEEEGQPTGEDLGLRRSWSQCPGCVFHSPKDLP.
For Research Use Only | Not For Clinical Use.
Online Inquiry