AibGenesis™ Mouse Anti-FAM172A Antibody (CBMOAB-59896FYC)


Cat: CBMOAB-59896FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-59896FYC Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio) WB, ELISA MO59896FYC 100 µg
CBMOAB-75836FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO75836FYA 100 µg
MO-AB-23980W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23980W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio)
CloneMO59896FYC
SpecificityThis antibody binds to Rhesus FAM172A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAM172A Antibody is a mouse antibody against FAM172A. It can be used for FAM172A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein FAM172A isoform 1; FAM172A
UniProt IDH9F8L4
Protein RefseqThe length of the protein is 226 amino acids long.
The sequence is show below: GYGVIVLNPNENYIEVEKPKIHVQSSSDSSDEPAEKRERKDKVSKETKKRRDFYEKYRNPQREKEMMQLYIRENGSPEEHAIYVWDHFIAQAAAENVFFVAHSYGGLAFVELMIQREADVKNKVTAVALTDSVHNVWHQEAGKTIREWMRENCCNWVSSSEPLDTSVESMLPDCPRVSAGTDRHELTSWKSFPSIFKFFTEASEAKISSLKPAVTRRSHRIKHEEL.
For Research Use Only | Not For Clinical Use.
Online Inquiry