AibGenesis™ Mouse Anti-FAM173A Antibody (CBMOAB-42326FYA)


Cat: CBMOAB-42326FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42326FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO42326FYA 100 µg
CBMOAB-75839FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO75839FYA 100 µg
MO-AB-03463H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03463C 100 µg
MO-AB-25740H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25740C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO42326FYA
SpecificityThis antibody binds to Rhesus FAM173A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAM173A Antibody is a mouse antibody against FAM173A. It can be used for FAM173A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFAM173A
UniProt IDI2CYT5
Protein RefseqThe length of the protein is 219 amino acids long.
The sequence is show below: MEQDDPAEALTELRERRLGALELLQAAAGSGLAAYAVWALLLQPGFRRVPLRLQVPYVGASARQVEHVLSLLRGRPGKTVDLGSGDGRIVLAAHRCGLRPAVGYELNPWLVALARLHAWRAGCAGSVCYRRKDLWKVSLRDCRNVSVFLAPSVLPLLEDKLRAELPAGARVVSGRFPLPTWQPVAVAGEGLDRVWAYDVPGGGQAGEAVSSRIPIQAAP.
For Research Use Only | Not For Clinical Use.
Online Inquiry