AibGenesis™ Mouse Anti-FAM174A Antibody (MO-AB-19000W)


Cat: MO-AB-19000W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-19000W Monoclonal Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO19000W 100 µg
MO-AB-25741H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25741C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO19000W
SpecificityThis antibody binds to Chimpanzee FAM174A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee FAM174A Antibody is a mouse antibody against FAM174A. It can be used for FAM174A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFamily with sequence similarity 174, member A; FAM174A
UniProt IDH2QRA0
Protein RefseqThe length of the protein is 190 amino acids long.
The sequence is show below: MKASQCCCCLSHLLASVLLLLLLPELSGPLAVLLQAAEAAPGLGPPDPRPRTLPPLPPGPTPAQQPGRGLAEAAGPRGSEGGNGSNPVAGLEADDHGGKAGEGSVGGGLAVSPNPGDKPMTQRALTVLMVVSGAVLVYFVVRTVRMRRRNRKTRRYGVLDTNIENMELTPLEQDDEDDDNTLFDANHPRR.
For Research Use Only | Not For Clinical Use.
Online Inquiry