AibGenesis™ Mouse Anti-FAM180A Antibody (CBMOAB-42339FYA)


Cat: CBMOAB-42339FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42339FYA Monoclonal Rhesus (Macaca mulatta), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO42339FYA 100 µg
MO-AB-01840Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01840Y 100 µg
MO-AB-18720W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18720W 100 µg
MO-AB-25744H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25744C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO42339FYA
SpecificityThis antibody binds to Rhesus FAM180A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionFAM180A (Family With Sequence Similarity 180 Member A) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus FAM180A Antibody is a mouse antibody against FAM180A. It can be used for FAM180A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFAM180A
UniProt IDF7G2H6
Protein RefseqThe length of the protein is 157 amino acids long.
The sequence is show below: XSMCHRWSRAVLFPAAHRPKRSSSLPLNPVLQNSLEEVELLFEFLLAELEISPDLQISIKDEELASLRKASDFRTVCNNVIPKSIPDIRRLSASLSSHPGILKKEDFERTVLTLAYAAYRTALSHGYQKDIWAQSLVSLFQALRHDLMRSSQPGVPP.
For Research Use Only | Not For Clinical Use.
Online Inquiry