AibGenesis™ Mouse Anti-FAM198B Antibody (CBMOAB-42380FYA)


Cat: CBMOAB-42380FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42380FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO42380FYA 100 µg
CBMOAB-75875FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO75875FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO42380FYA
SpecificityThis antibody binds to Rhesus FAM198B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAM198B Antibody is a mouse antibody against FAM198B. It can be used for FAM198B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFAM198B
UniProt IDF6UQW3
Protein RefseqThe length of the protein is 526 amino acids long.
The sequence is show below: MTCPDKPGQLINWFICSLCVPRVCKLWSSRRPRTRRNLLLGTACAIYLGFLVSQVGRASLQHGQVAEKGPHRSRDTAEASFPEIPLDGTLAPPESQGNGSTLQPNVVYITLRSKRSKPANIRGTVKPKRRKKHAVASAAPGQEALVGPSLQPQEAARAADAVAPGYAQGANLAKMGERPWRLVRGPGVRAGGPDFLQPSSRESNIRIYSESAPSWLSKDDIRRMRLLADSTVAGLRPVSSKSGARLLVLEGGAPGAVLRCGPSPCGLLKQPLDMSEVFAFHLDRILGLNRTLPSVSRKAEFIQAAAAACLSMRLAFFIFPAWEDMRVPGCCIGHTRLTWGTYQQLLKQKCWQNGRVPKPESGCTEIHHHEWSKMALFDFLLQIYNRLDTNCCGFRPRKEDTCVQNGLRPKCDNQGSAALAHIIQRKHDPRHLVFIDNKGFFDRSEDNLNFKLLEGIKEFPASAVSVLKSQHLRQKLLQSLFLDKVYWESQGGRQGIEKLIDVIEHRAKILITYINAHGAKVLPMNE.
For Research Use Only | Not For Clinical Use.
Online Inquiry