AibGenesis™ Mouse Anti-FAM213B Antibody (CBMOAB-42410FYA)


Cat: CBMOAB-42410FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42410FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO42410FYA 100 µg
CBMOAB-75926FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO75926FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO42410FYA
SpecificityThis antibody binds to Rhesus FAM213B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAM213B Antibody is a mouse antibody against FAM213B. It can be used for FAM213B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFAM213B
UniProt IDF7G9T2
Protein RefseqThe length of the protein is 201 amino acids long.
The sequence is show below: MSTVDLARVGACILKHAVTGEAVELRSLWRDRACVVAGLRRFGCVVCRWIAQDLSGLAGLLEQHGVRLVGVGPEALGLQEFLDGGYFAGELYLDESKQLYKELGFKRLWTQASLESGQATWCLRRYNSLSILPAALGKPVRDVAAKAKAVGIQGNLSGDLLQSGGLLVVSKEVPRRLCPPGAHPAGPGHLCGGLCQQPASG.
For Research Use Only | Not For Clinical Use.
Online Inquiry