AibGenesis™ Mouse Anti-FAM216B Antibody (CBMOAB-42416FYA)


Cat: CBMOAB-42416FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42416FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO42416FYA 100 µg
MO-AB-12318R Monoclonal Cattle (Bos taurus) WB, ELISA MO12318R 100 µg
MO-AB-25753H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25753C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO42416FYA
SpecificityThis antibody binds to Rhesus FAM216B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionFAM216B (Family With Sequence Similarity 216 Member B) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus FAM216B Antibody is a mouse antibody against FAM216B. It can be used for FAM216B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFAM216B
UniProt IDF6TNU8
Protein RefseqThe length of the protein is 114 amino acids long.
The sequence is show below: LNQGQQRYFYSIMRIYNSRPQWEALQTRYIHSLQHQQLLGNFSHFFPLRYITQREALSYALVLRDSTKRASAKVAPQRTISRKTSAMTRRCPSVLPVSVVLLRAQSKRGQMLRN.
For Research Use Only | Not For Clinical Use.
Online Inquiry