AibGenesis™ Mouse Anti-fam60a Antibody (CBMOAB-76000FYA)


Cat: CBMOAB-76000FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-76000FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Pig (Sus scrofa) WB, ELISA MO76000FYA 100 µg
MO-AB-01842Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01842Y 100 µg
MO-AB-12333R Monoclonal Cattle (Bos taurus) WB, ELISA MO12333R 100 µg
MO-AB-25764R Monoclonal Pig (Sus scrofa) WB, ELISA MO25764R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Pig (Sus scrofa)
CloneMO76000FYA
SpecificityThis antibody binds to Zebrafish fam60a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish fam60a Antibody is a mouse antibody against fam60a. It can be used for fam60a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFamily with sequence similarity 60, member A; fam60
UniProt IDQ5RJ79
Protein RefseqThe length of the protein is 245 amino acids long.
The sequence is show below: MFGFHKPKMYRSLDGCCICRAKSSSSRFTDSKRYERDFQSCFGLSETRSGEICNACVLLVKRWKKLPVGSKKNWNHVVDARGGPSLKTTVKSKKVKSLSRRIRPSQISRVQKELKRHNSDAHSTTSSASPAQSPSYSNQSDEGSDSELTPGSARSPVFSFLDLTYWKRQRVCCGIIYKGRFGEVLIDPHLYKPCCQKKQEQEQEEEEEEEEEDEDDGELEKEEVPSSQEIQPPQIKIEQEVDEEW.
For Research Use Only | Not For Clinical Use.
Online Inquiry