AibGenesis™ Mouse Anti-FAM8A1 Antibody (CBMOAB-42541FYA)


Cat: CBMOAB-42541FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42541FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio) WB, ELISA MO42541FYA 100 µg
CBMOAB-76041FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO76041FYA 100 µg
MO-AB-11675W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11675W 100 µg
MO-AB-12351R Monoclonal Cattle (Bos taurus) WB, ELISA MO12351R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio)
CloneMO42541FYA
SpecificityThis antibody binds to Rhesus FAM8A1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionFAM8A1 (Family With Sequence Similarity 8 Member A1) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus FAM8A1 Antibody is a mouse antibody against FAM8A1. It can be used for FAM8A1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein FAM8A1; FAM8A1
UniProt IDH9EY11
Protein RefseqThe length of the protein is 59 amino acids long.
The sequence is show below: MAEGHEEARGRPPGQDDGGGDHELVPSLKGPATTAVPCPRDDPQAEPQAPGRPIAAGLA.
For Research Use Only | Not For Clinical Use.
Online Inquiry