Mouse Anti-FBP1 Antibody (MO-AB-55286W)


Cat: MO-AB-55286W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-55286W Monoclonal Marmoset, C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chicken (Gallus gallus), French-bean, Frog (Xenopus laevis), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Yeast WB, ELISA MO55286W 100 µg
CBMOAB-42638FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO42638FYA 100 µg
CBMOAB-01302CR Monoclonal Yeast WB, ELISA MO01302CR 100 µg
CBMOAB-03552HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO03552HB 100 µg
MO-AB-36191W Monoclonal French-bean WB, ELISA MO36191W 100 µg
MO-AB-12399R Monoclonal Cattle (Bos taurus) WB, ELISA MO12399R 100 µg
MO-AB-25789R Monoclonal Pig (Sus scrofa) WB, ELISA MO25789R 100 µg
MO-AB-03506H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03506C 100 µg
MO-AB-01865Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01865Y 100 µg
MO-AB-08054Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08054Y 100 µg
MO-AB-15228Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15228Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset, C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chicken (Gallus gallus), French-bean, Frog (Xenopus laevis), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Yeast
CloneMO55286W
SpecificityThis antibody binds to Marmoset FBP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionFructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.
Product OverviewMouse Anti-Marmoset FBP1 Antibody is a mouse antibody against FBP1. It can be used for FBP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFructose-1,6-bisphosphatase 1; FBP1
UniProt IDF7DT76
Protein RefseqThe length of the protein is 338 amino acids long.
The sequence is show below: MADRAPFDTDVSTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSIGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYVQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKKAVLDIIPTDIHQRAPIVLGSPDDVLEFLEVCEKHSAQ.
See other products for " Fbp1 "
For Research Use Only | Not For Clinical Use.
Online Inquiry