AibGenesis™ Mouse Anti-fbxo3 Antibody (CBMOAB-76226FYA)


Cat: CBMOAB-76226FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-76226FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset WB, ELISA MO76226FYA 100 µg
MO-AB-02582W Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO02582W 100 µg
MO-AB-03519H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03519C 100 µg
MO-AB-10803W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10803W 100 µg
MO-AB-12428R Monoclonal Cattle (Bos taurus) WB, ELISA MO12428R 100 µg
MO-AB-55316W Monoclonal Marmoset WB, ELISA MO55316W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset
CloneMO76226FYA
SpecificityThis antibody binds to Zebrafish fbxo3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternative splicing of this gene generates 2 transcript variants diverging at the 3' end. (From NCBI)
Product OverviewMouse Anti-Zebrafish fbxo3 Antibody is a mouse antibody against fbxo3. It can be used for fbxo3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesfbxo3; F-Box Protein 3
UniProt IDF1R287
Protein RefseqThe length of the protein is 451 amino acids long.
The sequence is show below: MATSIALSLDNLPSDPLLLVLSFLDFRDLISCSFVSRRLNELTGHNPLWKRLCQKHWLLSEADKTQRGLSWKDLFREYYADLGRYFDYYSTLKKAWDDLKNFLNQKCPRMIASLKEGVREDELDTIEAQIGCKLPNDYRCSYRIHNGQKLVVPGLMGSMALSNHYRSEDLLDIETAAGGFQQRKGMRQCLPLTFCFHTGLSQYMALETTEGRTRSEIFYQCPDQLAQDPSAIDMFITGSNFTEWFTSYVDNVVTGEYPIIRDQIFRYVHDKRCVATTGDITVSVSTSFLPELSSVHPPHFFFTYRIRIEMAKSALPEKACQLDSRYWKITNANGNVEEVRGPGVVGEFPVMTPGKVHEYASCTTFSTTSEYMEGHYTFHRLKNKEEVFDVSIPRFHMVCPPFRESVVRSSSVSEVSAPYDDENSSDTDDYEEGEMRGMNMADPGGRCPRHV.
For Research Use Only | Not For Clinical Use.
Online Inquiry