AibGenesis™ Mouse Anti-FBXO48 Antibody (CBMOAB-42708FYA)


Cat: CBMOAB-42708FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42708FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO42708FYA 100 µg
MO-AB-18595W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18595W 100 µg
MO-AB-25786H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25786C 100 µg
MO-AB-55334W Monoclonal Marmoset WB, ELISA MO55334W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO42708FYA
SpecificityThis antibody binds to Rhesus FBXO48.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FBXO48 Antibody is a mouse antibody against FBXO48. It can be used for FBXO48 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesF-box only protein 48; FBXO48
UniProt IDH9F5Z8
Protein RefseqThe length of the protein is 81 amino acids long.
The sequence is show below: LWKPHCMTVRAVCRREIDDDLESGYSWRVILLRNYQKSKVKHEWLSGRYSNICSPISLPEKTMYPMDADTWGEILEAELER.
For Research Use Only | Not For Clinical Use.
Online Inquiry