Mouse Anti-Ferret ADORA2B Antibody (MO-AB-34339W)


Cat: MO-AB-34339W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFerret (Mustela Putorius Furo)
CloneMO34339W
SpecificityThis antibody binds to Ferret ADORA2B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an adenosine receptor that is a member of the G protein-coupled receptor superfamily. This integral membrane protein stimulates adenylate cyclase activity in the presence of adenosine. This protein also interacts with netrin-1, which is involved in axon elongation. The gene is located near the Smith-Magenis syndrome region on chromosome 17.
Product OverviewMouse Anti-Ferret ADORA2B Antibody is a mouse antibody against ADORA2B. It can be used for ADORA2B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenosine receptor A2; ADORA2B
UniProt IDM3YFS6
Protein RefseqThe length of the protein is 332 amino acids long.
The sequence is show below: MPLEAEDALYVALELAIAALSVAGNVLVCAAVGTSSALQTPTNYFLVSLAAADVAVGLFAIPFAITISLGFCTDFHSCLFLACFVLVLTQSSIFSLLAVAVDRYLAIRVPLRYKSLVTGTRARRVIAVLWVLAFGIGLTPFLGWNSKNTAANCTEPWDGATNASCCLVRCLFENVVPMSYMVYFNFFGCVLPPLLIMLVIYIWIFLEACRQLQRTELMDHSRTVIQREIHAAKSLAMIVGIFALCWLPVHAINCVTFFQPAKSKAKPKWVMNTAILLSHANSVVNPVVYAYRNRDFRYTFHKIISRYILCQTDVLKSGNGQAGAQPALDVGL.
For Research Use Only | Not For Clinical Use.
Online Inquiry