Mouse Anti-Rhesus ADORA2B Antibody (CBMOAB-35232FYA)


Cat: CBMOAB-35232FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO35232FYA
SpecificityThis antibody binds to Rhesus ADORA2B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an adenosine receptor that is a member of the G protein-coupled receptor superfamily. This integral membrane protein stimulates adenylate cyclase activity in the presence of adenosine. This protein also interacts with netrin-1, which is involved in axon elongation. The gene is located near the Smith-Magenis syndrome region on chromosome 17.
Product OverviewMouse Anti-Rhesus ADORA2B Antibody is a mouse antibody against ADORA2B. It can be used for ADORA2B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenosine receptor A2; ADORA2B
UniProt IDF6U813
Protein RefseqThe length of the protein is 331 amino acids long.
The sequence is show below: MLLETQDALYVALELVIAALSVAGNVLVCAAVGTASALQTPTNYFLVSLAAADVAVGLFAIPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLMAVAVDRYLAVCVPLRYKSLVTGTRARGVIAVLWVLAFGIGLTPFLGWNSKDSATNCTEPWDGTTNESCCLVKCLFENVVPMSYMVYFNFFGCVLPPLLIMLVIYIKIFMVACRQLQRTELMDHSRTTLQREIHAAKSLAMIVGIFALCWLPVHAVNCVTLFQPTQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRSTFRKIISRYLLCQADVKSGDGQAGVQPALGVGL.
See other products for " ADORA2B "
MO-AB-07063RMouse Anti-Cattle ADORA2B Antibody (MO-AB-07063R)
MO-AB-09590WMouse Anti-Cat ADORA2B Antibody (MO-AB-09590W)
MO-AB-28842WMouse Anti-Dog ADORA2B Antibody (MO-AB-28842W)
MO-AB-50514WMouse Anti-Marmoset ADORA2B Antibody (MO-AB-50514W)
MO-AB-34339WMouse Anti-Ferret ADORA2B Antibody (MO-AB-34339W)
MO-AB-19930WMouse Anti-Chimpanzee ADORA2B Antibody (MO-AB-19930W)
MO-AB-14098YMouse Anti-Sheep ADORA2B Antibody (MO-AB-14098Y)
CBMOAB-65072FYAMouse Anti-Zebrafish adora2b Antibody (CBMOAB-65072FYA)
MO-AB-23581RMouse Anti-Pig ADORA2B Antibody (MO-AB-23581R)
MO-AB-43589WMouse Anti-Horse ADORA2B Antibody (MO-AB-43589W)
For Research Use Only | Not For Clinical Use.
Online Inquiry