Mouse Anti-Ferret ARFRP1 Antibody (MO-AB-34405W)


Cat: MO-AB-34405W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFerret (Mustela Putorius Furo)
CloneMO34405W
SpecificityThis antibody binds to Ferret ARFRP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Cytosol; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a membrane-associated GTP-ase which localizes to the plasma membrane and is related to the ADP-ribosylation factor (ARF) and ARF-like (ARL) proteins. This gene plays a role in membrane trafficking between the trans-Golgi network and endosomes. Alternatively spliced transcript variants encoding different isoforms have been identified.
Product OverviewMouse Anti-Ferret ARFRP1 Antibody is a mouse antibody against ARFRP1. It can be used for ARFRP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesADP-ribosylation factor related protein 1
UniProt IDM3YAN1
Protein RefseqThe length of the protein is 201 amino acids long.
The sequence is show below: MYTLLSGLYKYVFRKDEYCILILGLDNAGKTTFLEQSKTRFHKGYRGMSLSKVTTTVGLNIGTVDVAKARLMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLGESKRAFEKMVTSEALDGVPILVLANKQDVETCLSIPDIKTAFSDCSSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT.
For Research Use Only | Not For Clinical Use.
Online Inquiry