Mouse Anti-Zebrafish arfrp1 Antibody (CBMOAB-66316FYA)


Cat: CBMOAB-66316FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO66316FYA
SpecificityThis antibody binds to Zebrafish arfrp1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a membrane-associated GTP-ase which localizes to the plasma membrane and is related to the ADP-ribosylation factor (ARF) and ARF-like (ARL) proteins. This gene plays a role in membrane trafficking between the trans-Golgi network and endosomes. Alternatively spliced transcript variants encoding different isoforms have been identified.
Product OverviewMouse Anti-Zebrafish arfrp1 Antibody is a mouse antibody against arfrp1. It can be used for arfrp1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesarfrp1; ADP Ribosylation Factor Related Protein 1
UniProt IDE7FAS3
Protein RefseqThe length of the protein is 201 amino acids long.
The sequence is show below: MYTLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQTKTRFSKNYKGMNLSKITTTVGLNIGTIDVGKARLMFWDLGGQEELQSLWDKYYAESHGVIYVIDSTDEERLGESKNAFEKMISSEALEGVPLLVLANKQDVENCLSVPDIKTAFSDCAPKIGKRDCLVQPCAALSGQGVNDGIEWMVKCVIRNIHRPPRQKDIT.
For Research Use Only | Not For Clinical Use.
Online Inquiry