Mouse Anti-Ferret GALM Antibody (MO-AB-34791W)


Cat: MO-AB-34791W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFerret (Mustela Putorius Furo)
CloneMO34791W
SpecificityThis antibody binds to Ferret GALM.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an enzyme that catalyzes the epimerization of hexose sugars such as glucose and galactose. The encoded protein is expressed in the cytoplasm and has a preference for galactose. The encoded protein may be required for normal galactose metabolism by maintaining the equilibrium of alpha and beta anomers of galactose.
Product OverviewMouse Anti-Ferret GALM Antibody is a mouse antibody against GALM. It can be used for GALM detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAldose 1-epimerase; EC 5.1.3.3; Galactose mutarotase; GALM
UniProt IDM3YG87
Protein RefseqThe length of the protein is 342 amino acids long.
The sequence is show below: MASVTRAVFGDLPSGAGTVEKFQLQSDLLKVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVVGRVANRIAKGTFTLDGKEYKLPVNNGPNSLHGGVRGFDKVLWTPQVLSNGVQFSRVSPDGEEGYPGELKVWVTYTLDGGELMINYRAQASRTTPVNLTNHSYFNLAGQGSPNIYDHEITIEADAFLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQEFRINGFDHNFCLKGSKEKHFCARVRHAGSGRVLEVYTTQPGVQFYTGNFLDGTLQGKRGAVYPKHSGFCLETQNWPDAVNQPHFPPVLLRPGEEYDHTTWFKFTVA.
See other products for " GALM "
MO-AB-12854RMouse Anti-Cattle GALM Antibody (MO-AB-12854R)
MO-AB-00542RMouse Anti-Medaka galm Antibody (MO-AB-00542R)
MO-AB-15350YMouse Anti-Sheep GALM Antibody (MO-AB-15350Y)
MO-AB-01999YMouse Anti-Chicken GALM Antibody (MO-AB-01999Y)
MO-AB-03795HMouse Anti-Frog galm Antibody (MO-AB-03795H)
MO-AB-41683WMouse Anti-Guinea pig GALM Antibody (MO-AB-41683W)
MO-AB-55813WMouse Anti-Marmoset GALM Antibody (MO-AB-55813W)
MO-AB-08152YMouse Anti-Rabbit GALM Antibody (MO-AB-08152Y)
MO-AB-13908WMouse Anti-Chimpanzee GALM Antibody (MO-AB-13908W)
CBMOAB-0951YCMouse Anti-E. coli galM Antibody (CBMOAB-0951YC)
For Research Use Only | Not For Clinical Use.
Online Inquiry