Mouse Anti-Frog galm Antibody (MO-AB-03795H)


Cat: MO-AB-03795H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO03795C
SpecificityThis antibody binds to Frog galm.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an enzyme that catalyzes the epimerization of hexose sugars such as glucose and galactose. The encoded protein is expressed in the cytoplasm and has a preference for galactose. The encoded protein may be required for normal galactose metabolism by maintaining the equilibrium of alpha and beta anomers of galactose.
Product OverviewThis product is a mouse antibody against galm. It can be used for galm detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAldose 1-epimerase; EC 5.1.3.3; Galactose mutarotase; galm; LOC100036941
UniProt IDA1L2T0
Protein RefseqThe length of the protein is 342 amino acids long.
The sequence is show below: MTSVTRDVFGQLLGGEGTVERFCLHSKEVRAEVISFGCIITRLETQDRNGTFSDLVLGFDVIEGYTNKHPYFGAVIGRVANRIANGKFTVKGKDYRLAINNGPNSIHGGLKGFDKVLWAPKIIENGVQFFYKSADGEEGYPGELNVWVTYTLIGRTLTVNYRAQSNNTTPINLTNHSYFNLAGQGSSNVYDHVVSIDADHYLPVDDTMIPTGEVAPVLGTCFDLRKPVELGSHLKSFHLDGFDHNFCLGVTQEQKQCARISHPLSGRVLTVSTTQPGVQFYTANFLDGSLKGKAGKVYPKHSAFCLETQGWPDAVNKPHFPSSLLNPGEEYNHTTCFEFSLI.
See other products for " GALM "
MO-AB-00495LMouse Anti-Elephant GALM Antibody (MO-AB-00495L)
MO-AB-15350YMouse Anti-Sheep GALM Antibody (MO-AB-15350Y)
CBMOAB-77486FYAMouse Anti-Zebrafish galm Antibody (CBMOAB-77486FYA)
CBMOAB-0951YCMouse Anti-E. coli galM Antibody (CBMOAB-0951YC)
MO-AB-12854RMouse Anti-Cattle GALM Antibody (MO-AB-12854R)
MO-AB-30879WMouse Anti-Dog GALM Antibody (MO-AB-30879W)
MO-AB-00542RMouse Anti-Medaka galm Antibody (MO-AB-00542R)
MO-AB-09332WMouse Anti-Cat GALM Antibody (MO-AB-09332W)
MO-AB-13908WMouse Anti-Chimpanzee GALM Antibody (MO-AB-13908W)
MO-AB-34791WMouse Anti-Ferret GALM Antibody (MO-AB-34791W)
For Research Use Only | Not For Clinical Use.
Online Inquiry