AibGenesis™ Mouse Anti-FEZF2 Antibody (CBMOAB-42825FYA)


Cat: CBMOAB-42825FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42825FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Zebrafish (Danio rerio) WB, ELISA MO42825FYA 100 µg
CBMOAB-76360FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO76360FYA 100 µg
MO-AB-01876Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01876Y 100 µg
MO-AB-12497R Monoclonal Cattle (Bos taurus) WB, ELISA MO12497R 100 µg
MO-DKB-00340W Polyclonal Zebrafish (Danio rerio) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Zebrafish (Danio rerio)
CloneMO42825FYA
SpecificityThis antibody binds to Rhesus FEZF2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FEZF2 Antibody is a mouse antibody against FEZF2. It can be used for FEZF2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFez family zinc finger protein 2; FEZF2
UniProt IDH9FBE3
Protein RefseqThe length of the protein is 341 amino acids long.
The sequence is show below: PVCGASGLCKTNCGVCCKAELGLAPSALPAGRVIKPQVINQAVGLPASGSLYYFNYLDSTAYPPSELLSGHLFPSGLLNAQAPAALAAHPKLFLLENAKLAGLAADKFPHPAPYPHKERLPAPLEQVLKENSALTAERGGVKGHSKLPGGSADGKPKNFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCNQCGKAFNRSSTLNTHIRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQYKCTICNKAFHQVYNLTFHMHTHNDKKPFTCATCGKGFCRNFDLKKHVRKLHDSVGPAAPSAKDLTRTVQS.
For Research Use Only | Not For Clinical Use.
Online Inquiry