AibGenesis™ Mouse Anti-FGF20 Antibody (CBMOAB-42856FYA)
Cat: CBMOAB-42856FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-42856FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Gorilla, Guinea pig (Cavia porcellus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO42856FYA | 100 µg | ||
| MO-AB-00458L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00458L | 100 µg | ||
| MO-AB-03580H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO03580C | 100 µg | ||
| MO-AB-12528R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO12528R | 100 µg | ||
| MO-AB-15261Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15261Y | 100 µg | ||
| MO-AB-25819H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25819C | 100 µg | ||
| MO-AB-25828R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO25828R | 100 µg | ||
| MO-AB-30777W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO30777W | 100 µg | ||
| MO-AB-34757W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34757W | 100 µg | ||
| MO-AB-38553W | Monoclonal | Gorilla | WB, ELISA | MO38553W | 100 µg | ||
| MO-AB-41651W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41651W | 100 µg | ||
| MO-AB-55420W | Monoclonal | Marmoset | WB, ELISA | MO55420W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Gorilla, Guinea pig (Cavia porcellus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries) |
| Clone | MO42856FYA |
| Specificity | This antibody binds to Rhesus FGF20. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a member of the fibroblast growth factor family. The fibroblast growth factors possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene product is a secreted neurotrophic factor but lacks a typical signal peptide. It is expressed in normal brain, particularly the cerebellum, and may regulate central nervous system development and function. Homodimerization of this protein was shown to regulate its receptor binding activity and concentration gradient in the extracellular matrix. Genetic variations of this gene have been associated with Parkinson disease susceptibility. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus FGF20 Antibody is a mouse antibody against FGF20. It can be used for FGF20 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | FGF20 |
| UniProt ID | F6Q3U3 |
| Protein Refseq | The length of the protein is 78 amino acids long. The sequence is show below: MAPLAEVGGFLGGLEGLGQQVGSHFLWPARHPAPPAAVLPHRLPPADPARRQRAGHPAGPQPLRYLGIHQCGSGTGQY. |
For Research Use Only | Not For Clinical Use.
Online Inquiry