AibGenesis™ Mouse Anti-FGFBP3 Antibody (CBMOAB-42865FYA)


Cat: CBMOAB-42865FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42865FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO42865FYA 100 µg
MO-AB-25833H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25833C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO42865FYA
SpecificityThis antibody binds to Rhesus FGFBP3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FGFBP3 Antibody is a mouse antibody against FGFBP3. It can be used for FGFBP3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFGFBP3
UniProt IDF7EC84
Protein RefseqThe length of the protein is 254 amino acids long.
The sequence is show below: MSPPRLRASLSPSLLLLLLSGCLLAAARREKGAASNVVEPVPGPTGGSSGRFLSPEQHACSWQLLLPAPGAAAGSELALRCQSPDGARHQCAYRGEPQRCVAYAARRAHFWKQVLGGLRKKRRPCHDPTPLQARWRGKRARCELRLCHARPAARLRAGSRGVQPRARSRGRPRERAPGPAAGITPPQSAPPKENPSERKTNGGKRKAALVPNEERPMGTGPDPDGLDGNAELTETYCAEKWHSLCNFFVNFWNG.
For Research Use Only | Not For Clinical Use.
Online Inquiry