Mouse Anti-fibin Antibody (CBMOAB-76534FYA)


Cat: CBMOAB-76534FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-76534FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO76534FYA 100 µg
MO-AB-12574R Monoclonal Cattle (Bos taurus) WB, ELISA MO12574R 100 µg
MO-AB-25842H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25842C 100 µg
MO-AB-25987W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25987W 100 µg
MO-AB-44767W Monoclonal Horse (Equus caballus) WB, ELISA MO44767W 100 µg
MO-AB-55478W Monoclonal Marmoset WB, ELISA MO55478W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus)
CloneMO76534FYA
SpecificityThis antibody binds to Zebrafish fibin.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Endoplasmic reticulum; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish fibin Antibody is a mouse antibody against fibin. It can be used for fibin detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFin bud initiation factor; fibi
UniProt IDA1IGX5
Protein RefseqThe length of the protein is 210 amino acids long.
The sequence is show below: MGTMASPLFILIACLLSMRVGGAFFAGPLYPEMSNGTFHHYFVPDGYYEENDDPEKCQMLFKMMDNRKCTLDEDQDSVIRDDFTIIKRHIEDAARVLEGIGKSISFDLDGEDSYGKYLRRETTQISEAFSNSEKSLLELEVKFKQSQENELKEEHKISDDFLNMIVHTRDVLKETLDISLGLKDKHELLSLIIRSHGTRLSRLKNDYMKV.
For Research Use Only | Not For Clinical Use.
Online Inquiry