AibGenesis™ Mouse Anti-FIT2 Antibody (MO-AB-12583R)


Cat: MO-AB-12583R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-12583R Monoclonal Cattle (Bos taurus), Fruit fly (Drosophila melanogaster), Goat (Capra hircus), Pig (Sus scrofa), Yeast WB, ELISA MO12583R 100 µg
CBMOAB-01329CR Monoclonal Yeast WB, ELISA MO01329CR 100 µg
MO-AB-02587W Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO02587W 100 µg
MO-AB-37209W Monoclonal Goat (Capra hircus) WB, ELISA MO37209W 100 µg
MO-AB-25851R Monoclonal Pig (Sus scrofa) WB, ELISA MO25851R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Fruit fly (Drosophila melanogaster), Goat (Capra hircus), Pig (Sus scrofa), Yeast
CloneMO12583R
SpecificityThis antibody binds to Cattle FIT2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle FIT2 Antibody is a mouse antibody against FIT2. It can be used for FIT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFat-inducing transcript protein, Fragment; FIT2
UniProt IDD7NM31
Protein RefseqThe length of the protein is 111 amino acids long.
The sequence is show below: LLPFIALTNYHLTGKAGLVLRRLSTLLVGTAIWYVCTAIFSNIEHYTGSCYQSPALEGERKEHQSKQQCHGEGGFWHGFDISGHSFLLTFCALMIVEEMAVLHELKTDRNH.
For Research Use Only | Not For Clinical Use.
Online Inquiry