AibGenesis™ Mouse Anti-FKBP3 Antibody (CBMOAB-42928FYA)
Cat: CBMOAB-42928FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-42928FYA | Monoclonal | Rhesus (Macaca mulatta), Bovine, Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Frog (Xenopus laevis), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO42928FYA | 100 µg | ||
| CBMOAB-76580FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO76580FYA | 100 µg | ||
| MO-AB-00479L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00479L | 100 µg | ||
| MO-AB-03622H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO03622C | 100 µg | ||
| MO-AB-06486Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06486Y | 100 µg | ||
| MO-AB-07775W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07775W | 100 µg | ||
| MO-AB-08099Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08099Y | 100 µg | ||
| MO-AB-10509W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO10509W | 100 µg | ||
| MO-AB-11434Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO11434Y | 100 µg | ||
| MO-AB-12596R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO12596R | 100 µg | ||
| MO-AB-15287Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15287Y | 100 µg | ||
| MO-AB-23225H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23225C | 100 µg | ||
| MO-AB-25856H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25856C | 100 µg | ||
| MO-AB-30813W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO30813W | 100 µg | ||
| MO-AB-33114H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33114C | 100 µg | ||
| MO-AB-44772W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44772W | 100 µg | ||
| MO-AB-55509W | Monoclonal | Marmoset | WB, ELISA | MO55509W | 100 µg | ||
| MOFY-0722-FY311 | Polyclonal | Bovine | WB, IHC, ICC, IP | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Bovine, Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Frog (Xenopus laevis), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO42928FYA |
| Specificity | This antibody binds to Rhesus FKBP3. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus FKBP3 Antibody is a mouse antibody against FKBP3. It can be used for FKBP3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Peptidyl-prolyl cis-trans isomerase; FKBP3 |
| UniProt ID | H9F8G3 |
| Protein Refseq | The length of the protein is 214 amino acids long. The sequence is show below: TVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLIFEVELVDID. |
For Research Use Only | Not For Clinical Use.
Online Inquiry