AibGenesis™ Mouse Anti-Fln Antibody (CBMOAB-16863FYA)


Cat: CBMOAB-16863FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-16863FYA Monoclonal Fruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster), Malaria parasite WB, ELISA MO16863FYA 100 µg
MO-AB-12625H Monoclonal Malaria parasite WB, ELISA MO12625C 100 µg
MO-NAB-00658W Monoclonal D. melanogaster (Drosophila melanogaster) IF, WB NW0580 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster), Malaria parasite
CloneMO16863FYA
SpecificityThis antibody binds to fruit fly Fln.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Fln Antibody is a mouse antibody against Fln. It can be used for Fln detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFlightin; Muscle protein 27; fln; FTN mp27
UniProt IDP35554
Protein RefseqThe length of the protein is 182 amino acids long.
The sequence is show below: MADEEDPWGFDDGGEEEKAASTQAGTPAPPSKAPSVASDHKADSVVAGTPANEEAAPEEVEEIKAPPPPPEDDGYRKPVQLYRHWVRPKFLQYKYMYNYRTNYYDDVIDYIDKKQTGVAREIPRPQTWAERVLRTRNISGSDIDSYAPAKRDKQLIQTLAASIRTYNYHTKAYINQRYASVL.
For Research Use Only | Not For Clinical Use.
Online Inquiry