AibGenesis™ Mouse Anti-fopnl Antibody (CBMOAB-76758FYA)


Cat: CBMOAB-76758FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-76758FYA Monoclonal Zebrafish (Danio rerio), Chicken (Gallus gallus), Rat (Rattus norvegicus) WB, ELISA MO76758FYA 100 µg
MO-AB-01930Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01930Y 100 µg
MO-AB-25875H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25875C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chicken (Gallus gallus), Rat (Rattus norvegicus)
CloneMO76758FYA
SpecificityThis antibody binds to Zebrafish fopnl.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionFOPNL (FGFR1OP N-Terminal Like) is a Protein Coding gene.
Product OverviewMouse Anti-Zebrafish fopnl Antibody is a mouse antibody against fopnl. It can be used for fopnl detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesfopnl; FGFR1OP N-Terminal Like
UniProt IDE7FBY4
Protein RefseqThe length of the protein is 148 amino acids long.
The sequence is show below: MATITELKSALRETLEARGVLGQLKARVRAEVFSALDDPNTPRPPLSHDNLLINELIREYLEFNKYRYTASVLTAESGQPEVPLDRDFLAKELNVAEDSSARSVFRPLLYGLFHHFLSSKEEHKGQIFLKGSATVTSQEPHGHRDAES.
For Research Use Only | Not For Clinical Use.
Online Inquiry