Mouse Anti-fos Antibody (CBMOAB-76762FYA)
Cat: CBMOAB-76762FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-76762FYA | Monoclonal | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Hamsters (Cricetinae), Human (Homo sapiens), Rat (Rattus norvegicus), Monkey (Macaca mulatta), Marmoset, Sheep (Ovis aries), Zebrafish | WB, ELISA | MO76762FYA | 100 µg | ||
| MO-AB-03664H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO03664C | 100 µg | ||
| MO-AB-08763W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08763W | 100 µg | ||
| MO-AB-12673R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO12673R | 100 µg | ||
| MO-AB-15293Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15293Y | 100 µg | ||
| MO-AB-20534W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO20534W | 100 µg | ||
| MO-AB-25877H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25877C | 100 µg | ||
| MO-AB-43144W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43144W | 100 µg | ||
| MO-AB-55602W | Monoclonal | Marmoset | WB, ELISA | MO55602W | 100 µg | ||
| MO-NAB-00322W | Monoclonal | Human (Homo sapiens), Rat (Rattus norvegicus), Monkey (Macaca mulatta) | ELISA, WB | NW0250 | 100 µg | ||
| MOFY-1222-FY61 | Polyclonal | Zebrafish | WB, IHC, ICC, IF, ELISA | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Hamsters (Cricetinae), Human (Homo sapiens), Rat (Rattus norvegicus), Monkey (Macaca mulatta), Marmoset, Sheep (Ovis aries), Zebrafish |
| Clone | MO76762FYA |
| Specificity | This antibody binds to Zebrafish fos. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death. |
| Product Overview | Mouse Anti-Zebrafish fos Antibody is a mouse antibody against fos. It can be used for fos detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | V-fos FBJ murine osteosarcoma viral oncogene homolog; fo |
| UniProt ID | Q6P0S4 |
| Protein Refseq | The length of the protein is 349 amino acids long. The sequence is show below: MMFTSLNADCDASSRCSTASPSGDSVGYYPLNQTQEFTDLSVSSASFVPTVTAISSCPDLQWMVQPMISSVAPSNGAAQSYNPSSYPKMRVTGAKTSNKRSRSEQLSPEEEEKKRVRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQNDIANLLKEKERLEFILAAHKPICKIPADASFPEPSSSPMGSISVPEIVTTSVVSSTPNTSITTSSSSLLFSSTASTDSFSSTTVKISDLEPTLEESLELLAKAELETARSVPDMDLSNSLYTQDWEPLYTPANTDLEPLCTPVVTCTPACTTYTSSFMFTYPENDVFPTSVHRRGSSSNDQSSDSLNSPTLLTL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry