AibGenesis™ Mouse Anti-fos Antibody (CBMOAB-76762FYA)


Cat: CBMOAB-76762FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-76762FYA Monoclonal Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Hamsters (Cricetinae), Human (Homo sapiens), Rat (Rattus norvegicus), Monkey (Macaca mulatta), Marmoset, Sheep (Ovis aries), Zebrafish WB, ELISA MO76762FYA 100 µg
MO-AB-03664H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03664C 100 µg
MO-AB-08763W Monoclonal Cat (Felis catus) WB, ELISA MO08763W 100 µg
MO-AB-12673R Monoclonal Cattle (Bos taurus) WB, ELISA MO12673R 100 µg
MO-AB-15293Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15293Y 100 µg
MO-AB-20534W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20534W 100 µg
MO-AB-25877H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25877C 100 µg
MO-AB-43144W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43144W 100 µg
MO-AB-55602W Monoclonal Marmoset WB, ELISA MO55602W 100 µg
MO-NAB-00322W Monoclonal Human (Homo sapiens), Rat (Rattus norvegicus), Monkey (Macaca mulatta) ELISA, WB NW0250 100 µg
MOFY-1222-FY61 Polyclonal Zebrafish WB, IHC, ICC, IF, ELISA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Hamsters (Cricetinae), Human (Homo sapiens), Rat (Rattus norvegicus), Monkey (Macaca mulatta), Marmoset, Sheep (Ovis aries), Zebrafish
CloneMO76762FYA
SpecificityThis antibody binds to Zebrafish fos.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death. (From NCBI)
Product OverviewMouse Anti-Zebrafish fos Antibody is a mouse antibody against fos. It can be used for fos detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesV-fos FBJ murine osteosarcoma viral oncogene homolog; fo
UniProt IDQ6P0S4
Protein RefseqThe length of the protein is 349 amino acids long.
The sequence is show below: MMFTSLNADCDASSRCSTASPSGDSVGYYPLNQTQEFTDLSVSSASFVPTVTAISSCPDLQWMVQPMISSVAPSNGAAQSYNPSSYPKMRVTGAKTSNKRSRSEQLSPEEEEKKRVRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQNDIANLLKEKERLEFILAAHKPICKIPADASFPEPSSSPMGSISVPEIVTTSVVSSTPNTSITTSSSSLLFSSTASTDSFSSTTVKISDLEPTLEESLELLAKAELETARSVPDMDLSNSLYTQDWEPLYTPANTDLEPLCTPVVTCTPACTTYTSSFMFTYPENDVFPTSVHRRGSSSNDQSSDSLNSPTLLTL.
For Research Use Only | Not For Clinical Use.
Online Inquiry