AibGenesis™ Mouse Anti-foxa3 Antibody (CBMOAB-76784FYA)


Cat: CBMOAB-76784FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-76784FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus) WB, ELISA MO76784FYA 100 µg
MO-AB-12676R Monoclonal Cattle (Bos taurus) WB, ELISA MO12676R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus)
CloneMO76784FYA
SpecificityThis antibody binds to Zebrafish foxa3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved. (From NCBI)
Product OverviewMouse Anti-Zebrafish foxa3 Antibody is a mouse antibody against foxa3. It can be used for foxa3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesForkhead box A3; foxa
UniProt IDQ1LV18
Protein RefseqThe length of the protein is 441 amino acids long.
The sequence is show below: MLSSVKMESHEIPEWNPFYSEANEMYSSPSAMNSVSSLNSYINLNSACSTSSMNMGYPSAGLNSSPLSSMGGGPNHMSLSPVGSSLNPSSLTQLGSSASTLGPLSHYQSMGQPMSQISYPSPTSLNRTKEMPKPYRRSLTHAKPPYSYISLITMAIQQSQSKMLTLNEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPNSGNMFENGCYLRRQKRFKIEEKAGKKSSSKSQDGSSTKGTHSSEGMQEEHSPTTGSDGAESAHSDSSHAGSTSEEQQRSLVQLDCPSQAPNLSHSSPVPIPSSVPSSMPPSSSHLHSQGMGNSPHLLGSPMHHLDLQNDPLKSMDPHFNFNHPFSITNLMSNEQKMDLKSYQDQVMAYNSYATSSPVAAKQIYDNAGPSAIDSGAYYQTLYSRSVLNAS.
For Research Use Only | Not For Clinical Use.
Online Inquiry