AibGenesis™ Mouse Anti-FOXRED1 Antibody (CBMOAB-43122FYA)


Cat: CBMOAB-43122FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43122FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO43122FYA 100 µg
CBMOAB-76898FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO76898FYA 100 µg
MO-AB-12685R Monoclonal Cattle (Bos taurus) WB, ELISA MO12685R 100 µg
MO-AB-18892W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18892W 100 µg
MO-AB-55630W Monoclonal Marmoset WB, ELISA MO55630W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO43122FYA
SpecificityThis antibody binds to Rhesus FOXRED1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that contains a FAD-dependent oxidoreductase domain. The encoded protein is localized to the mitochondria and may function as a chaperone protein required for the function of mitochondrial complex I. Mutations in this gene are associated with mitochondrial complex I deficiency. Alternatively spliced transcript variants have been observed for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus FOXRED1 Antibody is a mouse antibody against FOXRED1. It can be used for FOXRED1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFOXRED1
UniProt IDF6ZRH9
Protein RefseqThe length of the protein is 480 amino acids long.
The sequence is show below: MIRRVLPHGLGRGLLTRRPGTRRGGFSLDWDGKVSEIKKKIKSILPGTPCDVLPDTSHLPPEHSDVVIVGGGVLGLSVAYWLKQLENRRGGMQVLVVERDHTYSQASTGLSVGGICQQFSLPENIQLSLFSASFLRNINEYLAVTNAPPLDLQFNPSGYLLLASEKDAAAMESNVKVQKQEGAKVCLMSPDQLRNKFPWINTEGVALASYGMENEGWFDPWCLLHGLRQKLMSMGVFFCQGEVTRFVTSSQRMMTTDDEMVTLKSIHEVHVKMDHSLEYQPVECAIVINAAGAWSAQIAALAGIGKGPPGTLQGTKLPVEPRKSVASHPVSVIGNRTXRIRGFSGGLRAVLIDIRAPSRFEEEEPDPANLEVDHDFFQEKVWPHLALRVPAFETLKVQTAWAGYYDYNTFDQNGVVGPHPLVVNMYFATGFSGHGLQQAPGVGRAVAEMILEGSFQTIDLSPFLFNRFYLGEKTQENNIM.
For Research Use Only | Not For Clinical Use.
Online Inquiry