AibGenesis™ Mouse Anti-FOXS1 Antibody (MO-AB-12686R)


Cat: MO-AB-12686R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-12686R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes) WB, ELISA MO12686R 100 µg
Inquiry
MO-AB-22263W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22263W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes)
CloneMO12686R
SpecificityThis antibody binds to Cattle FOXS1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe forkhead family of transcription factors belongs to the winged helix class of DNA-binding proteins. The protein encoded by this intronless gene contains a forkhead domain and is found predominantly in aorta and kidney. The function of the encoded protein is unknown. (From NCBI)
Product OverviewMouse Anti-Cattle FOXS1 Antibody is a mouse antibody against FOXS1. It can be used for FOXS1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFOXS1 protein; FOXS1
UniProt IDA5PJI1
Protein RefseqThe length of the protein is 330 amino acids long.
The sequence is show below: MQQPPPPGPLAPAAEPTKPPYSYIALIAMAIQNSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFEHGSFLRRRRRFTRRAGAEGTKGPTKARRGPLRATSQDPGAPDVAASRQCPFPPEPLEPKGLSYGGLVGALPASMCPATTNARPQTPSEAKEMPTPKATGPGELPVATSSSSCPAFGFPTSFSEAEGFSKAPAPILTPEATIGSSYQCRLQAL.
For Research Use Only | Not For Clinical Use.
Online Inquiry