Mouse Anti-Frog aagab Antibody (MO-AB-01115H)


Cat: MO-AB-01115H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO01115C
SpecificityThis antibody binds to Frog aagab.
FormatLyophilized
StorageStore at 4°C: short-term (1-2 weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene interacts with the gamma-adaptin and alpha-adaptin subunits of complexes involved in clathrin-coated vesicle trafficking. Mutations in this gene are associated with type I punctate palmoplantar keratoderma. Alternatively spliced transcript variants have been found for this gene.
Product OverviewThis product is a mouse antibody against aagab. It can be used for aagab detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGC80342 protein; aagab; MGC80342
UniProt IDQ6INT6
Protein RefseqThe length of the protein is 309 amino acids long.
The sequence is show below: MASLPCVLLTSCAPGFNEEELVTKIIGTDEFPSNAQGDNAVKQYPWRIDNKYYCADVNICVVPSTTYVTAQIAETVQAFIVYFDSKMKLGLEKVSAWLPLLEDWVLDVMILVCDHVSETGVNHQTAQEWCIKHGFELVELNPEDLPDEDDDFPESTGVTRIVQALNANVWSNVEMKSEQAFGIFSSLAAVNHTPETSDDLQGDTPAPTEGTVDQCRGEDSGNPQDSQAETIVDPMLDLDIRELASLTSGEGDIENFSRLFSKLQEMKDKAATYPYEQRKLHAEKVAKAFWMAIGGDRDEIEGLSSGEES.
For Research Use Only | Not For Clinical Use.

Online Inquiry