Mouse Anti-Frog agps Antibody (MO-AB-01295H)


Cat: MO-AB-01295H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO01295C
SpecificityThis antibody binds to Frog agps.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPeroxisome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the FAD-binding oxidoreductase/transferase type 4 family. It encodes a protein that catalyzes the second step of ether lipid biosynthesis in which acyl-dihydroxyacetonephosphate (DHAP) is converted to alkyl-DHAP by the addition of a long chain alcohol and the removal of a long-chain acid anion. The protein is localized to the inner aspect of the peroxisomal membrane and requires FAD as a cofactor. Mutations in this gene have been associated with rhizomelic chondrodysplasia punctata, type 3 and Zellweger syndrome.
Product OverviewThis product is a mouse antibody against agps. It can be used for agps detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAgps-prov protein; agps; agps-prov
UniProt IDQ6DFB5
Protein RefseqThe length of the protein is 627 amino acids long.
The sequence is show below: MEAAQGSPVSALSQQRRLRVITGHLQTGAAPGISLNECKAPAASSSSAAPSIPKKRQEVLKWNGWGYNDSKFTFNKKGQAEFTGKRYKLSGMVLPALREWMEKTFGASLDQKTTSRASLNVSDAPPALVNEGFLQDIKAIGISYSQDTEDRIFRAHGHCLHEIFTLREGMFKRIPDIVVWPSCHEDVVKIVDLACKHNVCLIPFGGGTSVSYALECPEDEKRTIASLDTSQMSRILWIDEKNLTAHIEAGITGQDLERQLGESGYCTGHEPDSMEFSTLGGWVATRASGMKKNIYGNIEDLVVHIKMVTPKGIIEKSCQGPRMSTGPDIHHFIMGSEGTLGVVTEVTIKIRPVPEYQKYGSVVFPNFERGVACLREVARQRCAPASIRLMDNAQFQFGHALKPQVASIFTSFLDGLKKFYITKFKGFDPNQLCVATLLFEGDREKVLQHEKQVYDIAAKFGGLAAGEDNGQRGYMLTFVIAYLRDLGMDYYLIGESFETSVPWDRVLDLCRNVKERIVRECKERGVQFPPLSTCRVTQTYDAGACVYFYFAFNYRGLSDPVHVYEEIEFAAREEILANGGSLSHHHGVGKLRKQWLKDSISDVGIGMLRSVKNFVDPNNTFGNRNLL.
For Research Use Only | Not For Clinical Use.
Online Inquiry