Mouse Anti-Rat agps Antibody (MO-AB-23997H)
Cat: MO-AB-23997H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rat (Rattus norvegicus) |
Clone | MO23997C |
Specificity | This antibody binds to Rat agps. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Peroxisome |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene is a member of the FAD-binding oxidoreductase/transferase type 4 family. It encodes a protein that catalyzes the second step of ether lipid biosynthesis in which acyl-dihydroxyacetonephosphate (DHAP) is converted to alkyl-DHAP by the addition of a long chain alcohol and the removal of a long-chain acid anion. The protein is localized to the inner aspect of the peroxisomal membrane and requires FAD as a cofactor. Mutations in this gene have been associated with rhizomelic chondrodysplasia punctata, type 3 and Zellweger syndrome. |
Product Overview | This product is a mouse antibody against agps. It can be used for agps detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Alkyl-dihydroxyacetonephosphate synthase; EC 2.5.1.26; Agps; agps |
UniProt ID | Q9WUW6 |
Protein Refseq | The length of the protein is 81 amino acids long. The sequence is show below: MAEAAGEAGASERDPDAVRARRRLRVLSGHLLGRPQEAPSTNECKARRAASAAGASPAASPAAPESGTIPKKRQELMKWNG. |
See other products for " agps "
CBMOAB-65231FYA | Mouse Anti-Zebrafish agps Antibody (CBMOAB-65231FYA) |
CBMOAB-35335FYA | Mouse Anti-Rhesus AGPS Antibody (CBMOAB-35335FYA) |
MO-AB-50602W | Mouse Anti-Marmoset AGPS Antibody (MO-AB-50602W) |
CBMOAB-18555FYB | Mouse Anti-Rice AGPS Antibody (CBMOAB-18555FYB) |
MO-AB-01295H | Mouse Anti-Frog agps Antibody (MO-AB-01295H) |
MO-AB-41196W | Mouse Anti-Guinea pig AGPS Antibody (MO-AB-41196W) |
MO-AB-11541W | Mouse Anti-Chimpanzee AGPS Antibody (MO-AB-11541W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry