Mouse Anti-Frog atf3 Antibody (MO-AB-01672H)


Cat: MO-AB-01672H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO01672C
SpecificityThis antibody binds to Frog atf3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the mammalian activation transcription factor/cAMP responsive element-binding (CREB) protein family of transcription factors. This gene is induced by a variety of signals, including many of those encountered by cancer cells, and is involved in the complex process of cellular stress response. Multiple transcript variants encoding different isoforms have been found for this gene. It is possible that alternative splicing of this gene may be physiologically important in the regulation of target genes.
Product OverviewThis product is a mouse antibody against atf3. It can be used for atf3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGC81814 protein; atf3; MGC81814
UniProt IDQ68F43
Protein RefseqThe length of the protein is 181 amino acids long.
The sequence is show below: MMLQHPGQGSAAEVSATAIVPCLSPTMSFSFEDFTNLTPLVKEELRFAIQNKRFSTRAPCSLDSVVVSDGPLELTVPKSEFAPEEDDRKKRRRERNKVAAAKCRNKKKERTDSLQKESEKLESINADLKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKDGTLQS.
For Research Use Only | Not For Clinical Use.
Online Inquiry