Mouse Anti-Rhesus ATF3 Antibody (CBMOAB-36467FYA)


Cat: CBMOAB-36467FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO36467FYA
SpecificityThis antibody binds to Rhesus ATF3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the mammalian activation transcription factor/cAMP responsive element-binding (CREB) protein family of transcription factors. This gene is induced by a variety of signals, including many of those encountered by cancer cells, and is involved in the complex process of cellular stress response. Multiple transcript variants encoding different isoforms have been found for this gene. It is possible that alternative splicing of this gene may be physiologically important in the regulation of target genes.
Product OverviewMouse Anti-Rhesus ATF3 Antibody is a mouse antibody against ATF3. It can be used for ATF3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATF3
UniProt IDF7FN44
Protein RefseqThe length of the protein is 122 amino acids long.
The sequence is show below: MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSVTKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKKCQLQN.
For Research Use Only | Not For Clinical Use.
Online Inquiry