Mouse Anti-Frog btf3 Antibody (MO-AB-01947H)


Cat: MO-AB-01947H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO01947C
SpecificityThis antibody binds to Frog btf3.
FormatLyophilized
StorageStore at 4°C: short-term (1-2 weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the basic transcription factor 3. This protein forms a stable complex with RNA polymerase IIB and is required for transcriptional initiation. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.
Product OverviewThis product is a mouse antibody against btf3. It can be used for btf3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLOC495200 protein; btf3; LOC495200
UniProt IDQ5XGK2
Protein RefseqThe length of the protein is 162 amino acids long.
The sequence is show below: MKETIMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQSMDGNAPLASGEDEDDEVPDLVENFDEASKNESV.
For Research Use Only | Not For Clinical Use.

Online Inquiry